SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014482 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014482
Domain Number 1 Region: 289-472
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-44
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 9.94e-19
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 3 Region: 82-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000113
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014482   Gene: ENSDORG00000015388   Transcript: ENSDORT00000015389
Sequence length 487
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_13270:26033:36887:1 gene:ENSDORG00000015388 transcript:ENSDORT00000015389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQVSPPGLHDQLQCPICLEVFKEPLVLPCGHSYCKACLLSLSCHLASELRCPVCRRAV
DGSSSPPNVSLARVIEALRLPGDPEPTVCAHHRNPLSLFCEKDQELICGLCGLLGSHQHH
PVTPVSTVYSRMKEELAAFLSDLKQEQKEVDEHIAKLENNRTRIVNESDVFSWVIRREFQ
ELHRLVDEEKARCLEGIQGHTRGLLASLGLQLAQAQGARERLAQAARVQEQLGGASQLEF
IRKYHRLASRAELQQARPWEGAFSPISFKPALHQADIKLTVWKRLFRKVLPALECLRLDP
ATAHPLLELSKGDTVVQCGLLDQRRASQPERFDYNTCVLASRVLSCDRHYWEVTVGSKSD
WRLEIIKGTASRKGKLSKSPELGVWLIGLKDGRVYEAFGCPRVPKPVAGHPHRIGVYVHY
EQGELTFFNADRPDDLRPLYTFQDDFQGKLYPILDMSWHERGSNSLPLVLPPPTGPGHLP
SPQPTKL
Download sequence
Identical sequences ENSDORP00000014482 ENSDORP00000014482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]