SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014514 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014514
Domain Number 1 Region: 386-489
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.79e-19
Family Reprolysin-like 0.0041
Further Details:      
 
Domain Number 2 Region: 506-581
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.71e-17
Family Blood coagulation inhibitor (disintegrin) 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014514
Domain Number - Region: 293-331
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00953
Family Reprolysin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014514   Gene: ENSDORG00000015422   Transcript: ENSDORT00000015422
Sequence length 827
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1928:27077:197497:1 gene:ENSDORG00000015422 transcript:ENSDORT00000015422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGSSSWRPPLKSCSLAVASRNTSGDPSGPVPARAPPCRLLLVLIMLPALAASSRPRA
PGAAAPSALHWNETAEKNLGVLVDEDNPLQQNSSSNISYSNVMQKEITLPSRLIYYINQD
SESPYHVLDTKARHQHKHNKXXXXXXXXXXXXXXXXXXXXXXXXXXGLLSSDYVEIHYED
GKPQYSKGGEHCYYHGSIRGVKDSKVAMSTCNGLHGMFEDSTYVYMIEPLDLIHDEKSTG
RPHVIQKTLAGQYSTQLKNLSMDSSDQWPLLSELQWLKRRKRAVNPSRGVFEEMKYLELM
IVNDHTYKKHRSSHAHTNNFAKSVVNLVDSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXRVTFHYKRSSLSFFGGVCSRTRGVGVNEYGLPMAV
AQVLSQSLAQNLGIQWEPSSRKLKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQ
RGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPC
CNNTSCLFQPRGYECRDAVNGCDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECK
TRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNL
TRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRKC
LQIQALNMSSCPLDSKGKVCSGHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPKDEGP
KEMSRRGGLIRLSKAPSESAALDGYHLVLWGSGYDILVATLPELLHL
Download sequence
Identical sequences ENSDORP00000014514 ENSDORP00000014514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]