SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014526 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014526
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.93e-41
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014526   Gene: ENSDORG00000015434   Transcript: ENSDORT00000015434
Sequence length 134
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_1553:69552:71457:1 gene:ENSDORG00000015434 transcript:ENSDORT00000015434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTQCFEKGRIRCHQYWPEDNKPVTVFGDIVITKLMEDIQIDWTIRDLKIERHGDFMTVR
QCNFTGWPEHGVPENSTPLIHFVKLVRASRAHDTTPMIVHCSAGVGRTGVFIALDHLTQH
INDHDFVDIYGLVA
Download sequence
Identical sequences ENSDORP00000014526 ENSDORP00000014526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]