SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014536 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014536
Domain Number 1 Region: 322-426
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.1e-23
Family Reprolysin-like 0.0047
Further Details:      
 
Domain Number 2 Region: 523-579
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.66e-16
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 3 Region: 834-886
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014536
Domain Number - Region: 802-849
Classification Level Classification E-value
Superfamily FAS1 domain 0.0458
Family FAS1 domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014536   Gene: ENSDORG00000015444   Transcript: ENSDORT00000015444
Sequence length 888
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5582:38914:61501:-1 gene:ENSDORG00000015444 transcript:ENSDORT00000015444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPALAATRWPPLLLLLLLLLLLRPPAAGGAPAGPASEVVVPTRGPGGRAGELVLHLSAF
GAGFELRLAPDASFLAPEFKVELVGGSGGEAGAEPGLRGCFFSGTVNGEPESLAAVSLCR
GLSGSFLVAGEEFAIHPRGTGDSLDQPHVLQRWGLAGALPLPRGPEWEVARGKEQSQETG
DGDPEDGEEQRAEAGGAGDLPPPLRSTSRTKRFVSEARFVETLLVADASMASFYGADLQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXNFCGKEGQCDTLGVADIGTICDPSKSCSVIKDEGLQAAYTL
AHELGHVLSMPHDDSKPCARLFGPMSKHHMMAPLFVHLNQTLPWSPCSAMYLTELLDDGH
GDCLLDAPTSVLPLPTDLPGSKGLYALDQQCKQMFGPGFRHCPNTPPQDICAQLWCHTES
DEPLCHTKNGSLPWADGTPCGPEHLCLDGSCLPKEEVKKPKAVVDGGWGLWGPWGECSRT
CGGGVQFSHRECNNPEPQNGGRYCLGRRAKYQSCHTEECPYDXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGYNDIVTIPAGATNIDVKQR
SHPGVRNDGSYLALKTADGQYLLNGNLAISAIEQDILVKGTILKYSGSIATLERLQSFRA
LPEPLTVQLLTVPGEVFPPKVRYTFFVPNDTDFGKQNNKERATTNFIQPLLHAHWVLGDW
SECSVTCGAGWQRRTVECRDSSGQASTTCDKDLKPEDAKPCESQPCPL
Download sequence
Identical sequences ENSDORP00000014536 ENSDORP00000014536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]