SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014560 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000014560
Domain Number - Region: 69-151
Classification Level Classification E-value
Superfamily PUG domain-like 0.00115
Family PUG domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014560   Gene: ENSDORG00000015469   Transcript: ENSDORT00000015469
Sequence length 514
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_43241:489:2907:-1 gene:ENSDORG00000015469 transcript:ENSDORT00000015469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGEPSSMETKYKDELFRKYVQFHEGHVDAGPSQQRPGSDEFLRVAASTLLSLYKVDPFYR
FRLIQFYEVVESALRSLSGSSLRALHCAFSVLETVGVNLFLYPWKKEFRSIKTYTGPFVY
YVKSALLDEDVRTILSYMGYVPELGSAYKLRELVESLQVKMVSFELFLAKVECEQMLEIH
SQVKDKGYSELDVVGERKSSGEDARSCSEALRRRAEGREQLTASMARVALQKSASERAAK
DYYKPRVTKASRSVDAYDSCWESRRPPLKASLSLRKEPAATDVGDDPKDEFTRXXXXXXX
XXXXPHGSPGAMPPASTSNGPLLRGNYFSQEDVDLYTDSEPRATYRRQDAVRPDVWLVRS
DGPALYHKRSPPTKESVLSKCQNCGLPCSSSLCQRCDSLLACPPAAKPGAFPGKASAHDG
LALGAPLREKYAGQTQAPHAKPKPAAAATTTSRCGFCNRPGAANTCTQCSKVACEGCLSA
YHYDPCCKKGELHKFLPNSQLSYKTAPFSHLVYR
Download sequence
Identical sequences ENSDORP00000014560 ENSDORP00000014560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]