SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014568 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014568
Domain Number 1 Region: 50-364
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.27e-35
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 549-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000213
Family EGF-type module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014568   Gene: ENSDORG00000015477   Transcript: ENSDORT00000015477
Sequence length 651
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4174:50509:208227:-1 gene:ENSDORG00000015477 transcript:ENSDORT00000015477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSAHPGVFRMFLLLWFLPPTEGSQRTEPMFTAITNSVLPPDYDSNPTQLNYGVAVTDV
DHDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDID
GDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACV
DRMXXXXXXXXITNYAYGNVGPDALIEMDPEASDVSRGILALRDVAAEAGVSKYTAGRGV
SVGPILSNSASDIFCDNENGPNFLFHNQGNGTFVDAAASAGVDDPHQHGRGVALADFNRD
GKVDIVYGNWNGPHRLYLQMSAHGKVRFRDIASPKFSMPSPVRTVIAADFDNDQELEIFF
NNIASRSSSANRLFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXRDEASSVEVTWPDGKMVSRSVASKEMNSVLEILYPREEDKPQDSAPL
ECGQGFSQQENGHCMDTNECIQFPFMCPRDKPVCVNTYGSYRCRTNKRCNRGYEPNEDGT
ACVGTLGQSPGPCPATSRAAAATAAAAAAAGAATAAPVLIDGNLDLGLVKE
Download sequence
Identical sequences ENSDORP00000014568 ENSDORP00000014568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]