SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014580 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014580
Domain Number 1 Region: 2-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-24
Family SPRY domain 0.017
Further Details:      
 
Domain Number 2 Region: 201-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000797
Family Nucleotide and nucleoside kinases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014580   Gene: ENSDORG00000015491   Transcript: ENSDORT00000015491
Sequence length 532
Comment pep:novel scaffold:dipOrd1:scaffold_30679:6943:13348:-1 gene:ENSDORG00000015491 transcript:ENSDORT00000015491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKD
IDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFE
SDEVELSYAKNGQDLGIAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEDY
TFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHASENPGKYNILGTNTI
MDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKM
CLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEIT
YVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFN
MRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRGPVFPGRGGYSNRGNYNR
GGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
Download sequence
Identical sequences ENSDORP00000014580 ENSDORP00000014580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]