SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014582 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014582
Domain Number 1 Region: 223-442
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.76e-32
Family Leech intramolecular trans-sialidase, N-terminal domain 0.063
Further Details:      
 
Domain Number 2 Region: 680-824
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000807
Family Matrix metalloproteases, catalytic domain 0.073
Further Details:      
 
Domain Number 3 Region: 1469-1519
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000688
Family Complement control module/SCR domain 0.0074
Further Details:      
 
Domain Number 4 Region: 836-874,1058-1102
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000863
Family Fibronectin type III 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014582
Domain Number - Region: 1579-1636
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000106
Family Complement control module/SCR domain 0.007
Further Details:      
 
Domain Number - Region: 586-609
Classification Level Classification E-value
Superfamily Notch domain 0.00235
Family Notch domain 0.0044
Further Details:      
 
Domain Number - Region: 1408-1456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0142
Family Complement control module/SCR domain 0.0065
Further Details:      
 
Domain Number - Region: 1718-1747
Classification Level Classification E-value
Superfamily Notch domain 0.0432
Family Notch domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014582   Gene: ENSDORG00000015493   Transcript: ENSDORT00000015494
Sequence length 1780
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2018:760:219588:1 gene:ENSDORG00000015493 transcript:ENSDORT00000015494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMYFKILRISLVILAGWVFSTGSSELDRTPKKPLAPRSSPKQVQLEGERCWLGTTPQRPR
FAPQHHPFGVYPRRHGNHLRPYPAREQKTHQAEYSTPVTQGRAGSLAPQDPTDRPARARS
EAEQPADLWVQEGPIGQAELLTDDGTHLDNRGFQVTLGELETGGGSASAASLPTTFTPLE
EAQAETQKQDSPMSPQPHQVTKRQVEQGPEEPHVAPPRFHLWPKHLFRYGVRNHPLKDSI
QNGGRSPGREEDTSNPQGGLPVLYFSGRRERLLLQPEVLAESPREAFTVEVWVRPEGGQS
NPAIIAGVFDNCSHTITDKGWALGIRTGKERGRRDPRFFFSLRTDRVKKATLVTGHSHYQ
PGMWTHVAATYDGQRMVLYVDGAQVASRTGQSGPLHSPFMASCRSLLLGGDTSESGHYFR
GHLGTLIIWSTALSQSQLQSSSQAGDVGALLLTATFELLKEQWVPFKDETYPQLEVLKAW
EEPQPEVLSPLHPPPCGQTVCDNVELISQYNEHWPLRGEKVIRYQVVNVCDDAGLRPTVS
EEQISRQHAALAHAFARYNISWQLSVHRVHNSTLRHRVVLVNCEPSKIGNDHCDPECEHP
LTGYDGGDCRLQGRCYSWNRRDSVCHPECNNILNDFDGGDCCNPRVTDVRKTCFDPDSPL
RVYMSMKELKETLKLNSTHFLNIYFASSVREDLAGAATWPWDKEALGHLGGIVLNPTYYG
MPGHTDIMIHEIGHVLGLYHVFKEVSERESCDDCMETVPSMEGDLCADTVPTPKSKLCRD
PDPANDTCGLAHFPGAPFNNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQSRKPTP
IPIPPMVIGQTQKSLTIHWLPPIGGVIYDRTPGSMCDACTEDGTFRQYVYKASSQRVCDS
SGYWTPEEAVGPPDVHQPCEPSLQAWSPELHLYNTNMTVPCPPEGCSLELLFQYPVQADT
FTLWITYLSVNSSVALLDTEILLENQESVHLGPYHTFCDTPLTIKLPTEGKVLGVKVYTL
DERMEIDAALLTSLPGSALCSGCQPVRYQVLRDPPFASGSPVLMTHPYRTFTDREVTPGQ
MYEYQVQAEAGGELGEASPPLSHIHGDPYCGDGKVTGSLGEECDGGDLLNGDGCSRACKL
EEGFNCVGEPSLCYRYERDGICEPFEKETSIVDCGFHTPEGYLDQWATQAYSSHEDKKYP
VALVRGEPHSMICTSYHPDLPKHLPLTGWFPHVTSGKRPHDKESEQMEASLEKNDEIWLE
VCFSRPGLATAVFIFLASDGLALGEHQRPTVTLYIDVNGGNHSLGTHELSCQHNPLVINV
THHANTLFNQTTSMLLNFSSPLVGISAVALRTVEGISPSAPIDCISEQDHLEQSCAHRLC
GDQRSCAPMLFENTEKVNCSSSSPGHLECAITCQKGFVLQTSRGQQLRPMQEIVLTCFSG
HWDQNVSCVPLDCGIPDSSLVNFANFSCSEGTEYLKRCSISCIPPAKLRGLNPWLTCLED
GLWSLPEVYCKLECDAPPVIPNANLLLPRCLRDNQDVGTICKYEXXXXXXXXXXXXXXXX
XKFLNIQCLESGIWNQGSCSPVVCEPLSPVFEGMYECTNGFNLDSQCVLHCTQESERIPI
LCNKDGKWTQEFKLCANLQGECPPPPSELNFVEYKCEEGYGIGAVCFPSCVMPARDPVTL
PKNVTVDTMEHWVEAATVESIVCTGRRQWYPDPSLVHCIQSCEPFQADGWCDTINNRAYC
HYDGGDCCSSTLSSKKVIPFAANCDQDECTCRDPKAEENQ
Download sequence
Identical sequences ENSDORP00000014582 ENSDORP00000014582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]