SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014605 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014605
Domain Number 1 Region: 28-701
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.93e-204
Family Neutral endopeptidase (neprilysin) 0.0000000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014605   Gene: ENSDORG00000015517   Transcript: ENSDORT00000015518
Sequence length 701
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_21707:3840:11088:-1 gene:ENSDORG00000015517 transcript:ENSDORT00000015518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILATMLKYLGPGAAGGGACPEGCPERKAFARAARFLAANLDASIDPCQDFYSFACGGWLR
RHAIPDDKLTYGTIAAIGEQNEERLRRLLARPAGGPGGAAQRKVRAFFRSCLDMREIERL
GPRPMLEVIADCGGWDLGGAGPAAAGERPGSAARWDLNRLLYKAQGVYSAAALFSLTVSL
DDRNSSRYVIRIDQDGLTLPERTLYLAQDEESEKILAAYRVFMERLLRLLGAEAVEQKAQ
EILQLEQRLANITVSEYDDLRRDVSSMYNKVTLAQLQKITPHLRWKWLLDQIFQEDFSEE
EEVVLLLHAAGHAPQVRLLRPLLILHNYLLWRVVVALSEHLSTPFREALHELAREMEGSD
KPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQLVEDIKYILGQRLEELDWMD
AQTKAAARAKLQYMMVMVGYPDFLLKPEAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVK
KIRQEVDKSTWLLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQSLNFGGIGTIIGH
ELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLRKAECIVRLYDNFTVYNQRXXXXXXHGE
NIADMGGLKLAYYAYQKWVREHGPEHPLHRLKYTHNQLFFIAFAQNWCIKRRSQSIYSVL
TDKHAEHYRVLGSVSQFEEFGRAFHCPKDSPMNPTHKCSVW
Download sequence
Identical sequences ENSDORP00000014605 ENSDORP00000014605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]