SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014614 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014614
Domain Number 1 Region: 2-23,54-227
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.87e-26
Family GidA-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014614   Gene: ENSDORG00000015529   Transcript: ENSDORT00000015528
Sequence length 641
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2961:19:12605:1 gene:ENSDORG00000015529 transcript:ENSDORT00000015528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGVHYKVLNRRKGPAVWGLRAQIDRKL
YKQNMQKEILNTPLLTVREGAVEDLILSEPEPEHAGKCRVSGVVLVDGSTISAESVILTT
GTFLRGMIVIGLDKYPAGRLGDQSSVGLAQTLEKLGFTVGRLKTGTPPRIAKESINFSIL
NKQTPDNPSVPFSFLNETVWIKPEDQLPCYLTHTNPRVDGIVLENLHLNSHIKETTKGPR
YCPSIESKVLRFPNRVHQVWLEPEGLDSDLIYPQGLSVTLPAELQEKMITSIRGLEKAKM
IHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGVIAGINASLRASDRPPFIVSRTEGYIGVLIDDLTTQGTSEPYRMFTS
RVEFRLSLRPDNADNRLTFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTY
ESALFYQLQEIKEVQRDEALQLPEDLDYLTIRDVSLSDEVREKLHFSRPQTIGAASRIPG
VTPAAIVNLLRFVKTAQQRQAAAQELPPAKPCPPAAHTFQE
Download sequence
Identical sequences ENSDORP00000014614 ENSDORP00000014614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]