SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014663 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014663
Domain Number 1 Region: 145-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-46
Family Galectin (animal S-lectin) 0.00029
Further Details:      
 
Domain Number 2 Region: 1-68
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-20
Family Galectin (animal S-lectin) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014663   Gene: ENSDORG00000015578   Transcript: ENSDORT00000015578
Sequence length 278
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5342:932:8941:-1 gene:ENSDORG00000015578 transcript:ENSDORT00000015578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQVNFMVGQDPGADIAFHFNPRFDGWDKVVFNTKQGGQWGNEEKKRSMPFSKGTHFELVF
MVLDEHYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRPVTTPA
YPGPGYGTPPMSSLPXXXXXXXXXXPVPYTGRLQGGLTARKTIIIKGYVPPHSKSFAINL
KVSSSGDLALHINPRLGENAVVRNSFLNGSWGSEERKLSYNPFGAGQFFDLSIRCGLDRF
KVYANGQHLFDFSHRFTSFQRVDMVEVQGDVTLSYVQI
Download sequence
Identical sequences ENSDORP00000014663 ENSDORP00000014663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]