SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014664 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014664
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.1e-73
Family Tubulin, GTPase domain 0.0000000164
Further Details:      
 
Domain Number 2 Region: 188-274
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 7.02e-34
Family Tubulin, C-terminal domain 0.00000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014664   Gene: ENSDORG00000015580   Transcript: ENSDORT00000015579
Sequence length 275
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6909:333563:335003:1 gene:ENSDORG00000015580 transcript:ENSDORT00000015579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKYVLRAIMVDLEPGTLVSVRSGPFGQSVRPDNFIFAQSGAGNNWAKGHYTEGAELLESV
LDVVRQESERCDCLQGFQLAHSLGGGTGSGMGTLILNKIREEYPDHIMNTFSVMPSPKVS
DTVVEPYNAILSVHHLVENADETFCIDNEALYDICFRTLKLPTPTYGDLNHLVSATMSGV
TTCLRFAGQLNADLRKLAMNMVPFPRLHFFMAGFAPLTSRASQQYHVLSVPELTQQMFDA
KNMMVACDPRHGCYLTAAAIFRGRMSMKEVDEQML
Download sequence
Identical sequences ENSDORP00000014664 ENSDORP00000014664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]