SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014684 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014684
Domain Number 1 Region: 223-370
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.06e-32
Family Reprolysin-like 0.0055
Further Details:      
 
Domain Number 2 Region: 517-572
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000405
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 932-980
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000929
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 865-932
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 813-870
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014684   Gene: ENSDORG00000015603   Transcript: ENSDORT00000015603
Sequence length 1170
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1849:47387:197035:-1 gene:ENSDORG00000015603 transcript:ENSDORT00000015603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPPGRGAQRILAVPVRTDAQGRLVSHVVSLAAAGAGVRARRAAPLQTSGFPEGSGEEDPG
RHHVFYNVTVFGRDLHLRLRPNARLVAPGATVEWQEESGATRVEPLLGSCFYVGDVAGLA
KASSVALSNCDGLAGLIRMEEEEFFIEPLEKGLAEQEAEQGRVHVVYRRPPTPKPPPLGG
PQVLDTGASWGNLDSLSRALGVLEDRINSSRRRTRRHVTDDDYNIEVLLGVDDSVVQFHG
KEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSHAKSMSLIEIGNPSQSLENVC
RWAYLQQKPDTDHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSA
FVVAHETGHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSY
DCLRDDPFAHDWPALPQLPGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNP
YFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKRDGNWGAWTPFGSCSRTCGTGVKF
RTRQCDNPHPANGGRTCSGLAYDFQLCNPQDCPDTLADFREEQCRQWDLYFEHGDAQHHW
LPHEHRDAKERCHLYCESKETGEVVSMKRMVHDGTRCSYKDAFSVCVRGDCRKVGCDGVI
GSSKQEDKCGVCGGDNTHCKVVKGTFTRSPKKHDYIKMFEIPSGARHLLIQETDSASHHL
SVKSLETGKFILNEENHVDPNSRSFIALGVEWEYRNEDDRETLQTMGPLHGTITVLVIPE
GDGRISLTYKYMIHEDSLNVDDNNVLEDDSVRHEWALKKWSPCSKPCGGGSQFTKYGCRR
KLDHKMVHRAFCGALPKPKAIRRTCNPQECSQPVWVTGEWEPCSQSCGRTGMQVRAVRCI
QPLHNNTTRSVHTKHCNDNRPESRRACNRELCPGRWRAGPWSQCSVTCGNGTQERPVLCR
TGDDSFGVCLEARPETARICRLGPCPRNTSDPSKKSYVVQWLSRPDADAPMAKTSSKDHC
QGDKSMFCRMEVLSRYCSIPSYNKLCCKFCNLQNNLTDLDDRAEPPPGKHNDIEVFMPTL
PGPTLATQTQPSPGASPEIPLNVSSVNASSTEDHPETNALDVPYKVHGLDDEAQPPNLIP
RRPSLYEKTRNQRIQELIDAMRKKEARRKA
Download sequence
Identical sequences ENSDORP00000014684 ENSDORP00000014684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]