SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014754 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014754
Domain Number 1 Region: 389-483,516-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.59e-35
Family Calponin-homology domain, CH-domain 0.0000884
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.28e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 785-818
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000571
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014754
Domain Number - Region: 819-847
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000124
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014754   Gene: ENSDORG00000015680   Transcript: ENSDORT00000015680
Sequence length 965
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1046:58359:115158:-1 gene:ENSDORG00000015680 transcript:ENSDORT00000015680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENKHEVMNQAHVLFDRFVQATTCKGTLRAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWTKLDKRGSHKDYRKGKACANTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRSLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYXXXXXXXX
XXXXXXXXXXXXXXXXDYTDTELLLSRENVDQEALLNYAREAADFSTQHQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREHNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGSSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNININFLR
PSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGIPPIMTGKD
MASVGAPDKLSMVMYLTQFYEMFKDSLSCADHLDLNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLEGTGKRRKTSQSEEEEAPRSCRGERPTLVSTLTDRRMDIAVGNQN
KVKYMATQLLAKFEENAPSAQSSSVRRQPAQERGVSQPSCCLSEQGRPAPTPQWKQGSIK
KEFPQNLGGSDTCYFCQKRVYVMERLSAEGKFFHRSCFKCEFCATTLRLSAYAYDTEDGK
FYCKPHYCYRLSGYAQRKRPAVAPPSGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPG
VNGLEEPSIAKRLRGTPERIELENYRRSVRLAEELEEVPEETQAEHNLSSVLDKGTEEDV
ASRSV
Download sequence
Identical sequences ENSDORP00000014754 ENSDORP00000014754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]