SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014772 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014772
Domain Number 1 Region: 22-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.16e-38
Family G proteins 0.0000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014772   Gene: ENSDORG00000015699   Transcript: ENSDORT00000015699
Sequence length 282
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3402:20819:21796:-1 gene:ENSDORG00000015699 transcript:ENSDORT00000015699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDTYTPTIEDF
HRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQ
ILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKK
NSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGGGDT
GDAFGIVAPFARRPSVHSDLMYIREKASGGGQTKDKERCVIS
Download sequence
Identical sequences A0A1S3GWD0
ENSDORP00000014772 ENSDORP00000014772 XP_012893193.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]