SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014774 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014774
Domain Number 1 Region: 2037-2165
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-42
Family C-type lectin domain 0.000000331
Further Details:      
 
Domain Number 2 Region: 96-206
Classification Level Classification E-value
Superfamily C-type lectin-like 1.32e-39
Family Link domain 0.0013
Further Details:      
 
Domain Number 3 Region: 412-512
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-39
Family Link domain 0.0013
Further Details:      
 
Domain Number 4 Region: 207-300
Classification Level Classification E-value
Superfamily C-type lectin-like 8.47e-28
Family Link domain 0.0025
Further Details:      
 
Domain Number 5 Region: 2166-2226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000959
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 6 Region: 14-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000786
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014774   Gene: ENSDORG00000015702   Transcript: ENSDORT00000015702
Sequence length 2251
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4305:2658:27817:1 gene:ENSDORG00000015702 transcript:ENSDORT00000015702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPAHPVTTAPFTAALAPRIKWSRVSKEEEVVLLVATEGRVRVHSAYRNKVSLPNYPAIPS
DATLELQSLRSNDSGVYRCEVTHGIADSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRA
CLQNSAVIATAEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYG
IRDTNETYDVYCFAEEMEGEVFYATSPEKFTFQEAASECRRLGARLATTGQLYLAWQGGM
DMCSAGWLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPSSRYDAICYTGEDF
LDIPENFFGLGGEEDITVQTVTWPDLELPLPGNATEGEARGNVILTAKPLFHLSPTTPEP
DAPFPVAPEATRPWDLPEESTPGLGPATAFTSQDPVVQVTVVPGQPGSSGGVVFHYRPGS
TRYSLTFEEAGQACLRTGAVMASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVSPRTPCV
GDKDSSPGVRTYGVRPSSETYDVYCYVAELQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVSVAPSPGEDKHGTATPPTGPEDWIVTQVRPDVAAVPPGLDRTPPSTIEP
ESHTAWEPVDTLVATTSPAGTPATWTASGPEAEGATEGATEGATEEPRKGPEEPGGLPLP
LSLEPSASESPEGLSSPSPRGTEPPPPGSGEASGAPDLTGSGEAWGGPDASGQPSGGSGS
GQPSGDLDLHGLTSTAGSGEEDGVEQAGRPGVGSLPSAGQGADGSTSGAEDLSGRPSGDG
LETSASGVEDLSGRPSGEEGLETSASGLGDLSGRPSGGEGLETSTSGGWDVSGWPSGGEG
PETSTSGVDLSGISSGRENLETSASGIEDLHVLPTEKEGLETSASGGWDVSGLPSGGEGL
ETSTSGDEDLSVLPTSGEGLETSTSGDEDLSVLPTSGESLETSTSGDEDLSVLPTSGERL
ETSTSGDEDLSVLPTSGEGLETSTSGDEDLSGLPTRGGLETSASGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSGGSSAYPEAGEPASGEALWSTPAAFPEAGLASASGLGASGSPWAFQE
GSGEGTAGPEVNTEVTTGYDVDTEARVAPSASGDRTEISGDPSGHTSGPDTDITASIVEF
EQPTEGPAEAHLETESLSPWQTEDQTQTSNTAAAPTDASSPTSRTQGSGEAEWTDEDQEV
CEEGWTKFQGHCYRHFPDRETWVDAERRCRELQAHLSSVLTQEEQEFVNKNAQDYQWVGL
NDRTIEGDFRWSDGHPLQFEKWRPNQPDNFFAAGEDCVVMIWHEAGEWNDVPCNYHLPFT
CKKGTVACGAPPAVEHARTLGQKRDRYEINSLVRYQCTDGFVQRHVPTIRCQPSGYWEEP
RVTCTDTTTYKSKRQKRSWRHTRHSLPRAAH
Download sequence
Identical sequences ENSDORP00000014774 ENSDORP00000014774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]