SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014778 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014778
Domain Number 1 Region: 203-361
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.78e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000239
Further Details:      
 
Domain Number 2 Region: 43-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000887
Further Details:      
 
Domain Number 3 Region: 1-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000187
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014778   Gene: ENSDORG00000015707   Transcript: ENSDORT00000015706
Sequence length 361
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4305:37574:43728:-1 gene:ENSDORG00000015707 transcript:ENSDORT00000015706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCSPNPCHHDAECQVARDDLRGDVFTSYVCRCPRGYSGTHCETPCATPLGMEGGSIGDAQ
LSASSVHLGFLGLQRWGPELARLRRSGLVNAWTASNYDKKPWIQVNLLRKMRVTGVVTQG
ASRAGTSEYLKAFKVAYSLDGRRFQFIQNKRGHKEFEGNMDNDSLKINMFKTPLETQFVR
LFPVACRRGCTLRFELLGCELNGCSGPLGLKDGSIPDRQLTASSSYKTLGLRAFGWYPFY
ARLDRQGKINAWTAQGNGANEWLQVDLGSQKQVTGIVTQGARDFGHIQYVAAYKVAYSDD
GEVWTEYREAGATESKVFPGNLDNYSHKKNVLETPFTARYVRVLPVAWHNRITLRLELLG
C
Download sequence
Identical sequences ENSDORP00000014778 ENSDORP00000014778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]