SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014779 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014779
Domain Number 1 Region: 854-1116
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.82e-96
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000157
Further Details:      
 
Domain Number 2 Region: 1150-1307
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.4e-41
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00042
Further Details:      
 
Domain Number 3 Region: 2-157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-40
Family MAM domain 0.0000000345
Further Details:      
 
Domain Number 4 Region: 256-354,448-552
Classification Level Classification E-value
Superfamily Fibronectin type III 6.78e-25
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 5 Region: 1365-1424
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.92e-17
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0012
Further Details:      
 
Domain Number 6 Region: 213-263
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000143
Family I set domains 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014779
Domain Number - Region: 571-608,661-709
Classification Level Classification E-value
Superfamily Fibronectin type III 0.051
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014779   Gene: ENSDORG00000015704   Transcript: ENSDORT00000015707
Sequence length 1426
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5454:54560:418960:1 gene:ENSDORG00000015704 transcript:ENSDORT00000015707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCVFDEPYSTCGYSQSEDDDFNWDQVNTLTKPTSDPWMPSGSFMLVNTSGRPEGQRTHLL
LPQLKENDTHCIDFHYFVSSKSNAAPGLLNVYVKVNNGPLGNPIWNISGDPTRTWNRAEL
AISTFWPNFYQVIFEVVTSGHQGYLAIDEVKVLGHPCXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXGIDVQDAPLKEIKVTSSRRFIASFNVVNTTKRDAGKYRCMIRTE
GGVGISNYAELVVKEPPVPIAPPQLASVGATYLWIQLNANSINGDGPIVAREVEYCTASG
SWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGEGGTGSPGPALRTRTKCAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGAVPTESIQGSTFEEKIFLQWRE
PTQTYGVITLYEIVYKAVSSFDPEIDLSNQSGRVSKLGNETHFLFFGLYPGTTYSFTIQA
STAKGFGPPATNQFTTKISAPSMPAYELETPLNQTDNTVTVLLKPAQSRGAPVSVYQIVV
EEERPRRTKKTTEILKCYPVPIHFQNASILNSQYYFAAEFPADSLQAAQPFTIGDNKTYN
GYWNTPLLPHKSYRIYFQAASRANGETKIDCVRVATKGAATPKPVPEPEKQTDHTVKIAG
VIAGILLFVIIFLGVVLVMKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSVSSPSSFTMKTNTLSTSVPNSYYPDETHTMASETSSLVQSHTYKKRE
TADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQSAPWDSAKKDENRM
KNRYGNIIAYDHSRVRLQTIEGDTNSDYINGNYIDGYHRPNHYIATQGPMQETVYDFWRM
VWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKR
GVHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQVKSKSPPNAGPLVVHCSAGAGRTGCF
IVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXMNKLDPQTNSSQIKEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPD
RCLPFLITIDGESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVML
NDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLEEDIISRIFRIYNAARXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGGGRSGTFCAISIVC
EMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNSG
Download sequence
Identical sequences ENSDORP00000014779 ENSDORP00000014779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]