SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014808 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000014808
Domain Number - Region: 258-299
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0288
Family Frizzled cysteine-rich domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014808   Gene: ENSDORG00000015739   Transcript: ENSDORT00000015739
Sequence length 538
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3780:2169:323829:-1 gene:ENSDORG00000015739 transcript:ENSDORT00000015739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETVRPACLLVVAMLLSLDCLGQAQPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVR
HAKNYTNAMFKNNYPSLTPQAFEFVSEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYT
QIMNPGLPESALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVI
NTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
LSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNGGKLTTTGSNKIYFLFFFLLIIG
KLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFINFYSALP
GYVCSHXXXXXXXXXXXXXXXXXXXYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKL
KHINQLLRTMSVPKGRVVDKNLDDEGLESGDCGDDEDECIGASGDGMMKVKNQLRFLA
Download sequence
Identical sequences ENSDORP00000014808 ENSDORP00000014808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]