SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014842 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014842
Domain Number 1 Region: 149-245
Classification Level Classification E-value
Superfamily LCCL domain 9.55e-25
Family LCCL domain 0.00073
Further Details:      
 
Domain Number 2 Region: 35-99
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000288
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014842   Gene: ENSDORG00000015776   Transcript: ENSDORT00000015776
Sequence length 555
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4778:9373:93283:1 gene:ENSDORG00000015776 transcript:ENSDORT00000015776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGGELAGTAGPGLLALLLAVCAPLRLQAEELGDGCGHIVTSQDSGTMTSKNYPGTYPNH
TVCEKTITVPKGKSLILRLGDVNIESQSCASNYLLFTSSLEKYXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLITCLERGSHYLKTKFSKFCPAGCKDIAGDI
SGNTVDGYRDTSLLCKAAIHAGIITDELGGQISILQSKGLSRYEGILANGVLSRHGSLSE
RRFLFASNITGNDSSVPREMVSETGVSTEREDKAITKPIPSGETPTGLNVTTVAIPLVLL
VALLLAGMGVFAVYRKRKKKGNPYISAEAQKTDCWKQIKYPFARHQSSEFTISYDNEKEM
PQKLDLITSDMEDYQQPLMIGTGTVTRKGSTFRPMDTDTKGESGVSAEDGGHYDCPQRAG
AGGAGQHEYALPLAQAEPEYATPIVERHVLRAHSFSASSGCGYRVPGPRPVHKHSLSSGG
FCPAAGAQGGDYQMPPGPKPADGDYDKPQTSSFLAVENRDPASPKPQVHPELNDGYSSPR
NCLTPLHQTAMTALL
Download sequence
Identical sequences ENSDORP00000014842 ENSDORP00000014842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]