SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014845 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014845
Domain Number 1 Region: 78-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.45e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 135-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000199
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 233-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000251
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014845
Domain Number - Region: 194-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 269-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0185
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014845   Gene: ENSDORG00000015779   Transcript: ENSDORT00000015779
Sequence length 309
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3586:4080:25069:1 gene:ENSDORG00000015779 transcript:ENSDORT00000015779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGSWSALLLLVLLVCSKSWAAQNCLNRQQLLTAIRQLEQLLKAHETRFAEGIHNMKSR
LAELHNSVSKVAPDSAPVSCPALNAPSDGRKFGSKYLVDHEVHFTCNAGFRLEGLSSVVC
LPNGTWTGEQPHCRDISACASQPCHNGGTCIEEVNQYRCICPPGRSGGHCEHQAQTXXXX
XXXXXXXXFSREPRCSQVERVQLCSCEEGFHLSRDVCQDVDECELFAQERHLRLCMHTCV
NTPGSYSCTCPSGYQIMADGKSCEDIDECVSPHVCPQATTCINTSGGFQCVSPECPKGSG
NVSYVKTSP
Download sequence
Identical sequences ENSDORP00000014845 ENSDORP00000014845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]