SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014860 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014860
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-39
Family Dual specificity phosphatase-like 0.000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014860   Gene: ENSDORG00000015794   Transcript: ENSDORT00000015794
Sequence length 173
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_9174:12694:18177:1 gene:ENSDORG00000015794 transcript:ENSDORT00000015794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVSYRNMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKAPLEK
DGITVXDWPFDDGAPPPGKVVEDWLSLLKAKFCDDPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLSYLEKYRPKQRLRFKDPHAHKTKCCVM
Download sequence
Identical sequences ENSDORP00000014860 ENSDORP00000014860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]