SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014912 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014912
Domain Number 1 Region: 77-135
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000497
Family AN1-like Zinc finger 0.0013
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000112
Family AN1-like Zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014912   Gene: ENSDORG00000015852   Transcript: ENSDORT00000015852
Sequence length 141
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_44061:2082:6650:-1 gene:ENSDORG00000015852 transcript:ENSDORT00000015852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPDLGKHCSEKTCKQLDFLPLKCDACKQDFCKDHFTCATHTCPFAFKKDVRVPVCPLC
NVPVPVKKGELADVVVSEHMDRDCAVLQREKVFAHRCSRAGCRRKEMLQLLCVQCQRNFC
IQHRHPLDHSCSSSGSSASRA
Download sequence
Identical sequences ENSDORP00000014912 ENSDORP00000014912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]