SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014915 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014915
Domain Number 1 Region: 379-555
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-67
Family Transglutaminase core 0.00000345
Further Details:      
 
Domain Number 2 Region: 93-245
Classification Level Classification E-value
Superfamily E set domains 3.5e-44
Family Transglutaminase N-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 680-779
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.02e-29
Family Transglutaminase, two C-terminal domains 0.0006
Further Details:      
 
Domain Number 4 Region: 569-679
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.54e-27
Family Transglutaminase, two C-terminal domains 0.00045
Further Details:      
 
Domain Number 5 Region: 246-321
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.13e-19
Family Transglutaminase core 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014915   Gene: ENSDORG00000015854   Transcript: ENSDORT00000015855
Sequence length 801
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_950:3865:20490:-1 gene:ENSDORG00000015854 transcript:ENSDORT00000015855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMEGPRSDVGRWGGNPWQPSTTPEPQPEPESDRRNRRGRGRERRSFWARCCGCCSCRNRD
DDDDWGPEPSRNRASGSRDRRPPSRGTGVNAAGDGTIREGMLVVTGVDLLSSRSDQNRRE
HHTDEFEYDELIVRRGQPFHAILFLNREYESSDRIALELLIGNNPEVGKGTHVIIPVGKG
GSGGWKAQVIKASGHSLELRVHTSPSAIIGKFQFTVRTRSEAGEFQLPFDPQNEIYILFN
PWCPDDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRR
GMPYGGRGDPVSVSRVISAMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLN
HDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVQSVKNGLVYMK
YDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITHIYKHPE
GSAAERKAVETAAAHGSKPNVYETRDTAEDVSMQVEAQDAVMGQDLTVSIVLTNRGSSRR
TVKLHLYLSVTFYTGVTGSIFKETKKEVTLAPGSSDSVTMPVAYKEYRPHLVDQGAMLLN
VSHVKESGQVLAKQHTFRVRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLE
GSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGAIQVDVAPA
SGSRGFSDAGGEIPMASRGGA
Download sequence
Identical sequences ENSDORP00000014915 ENSDORP00000014915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]