SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014953 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014953
Domain Number 1 Region: 330-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.47e-23
Family Laminin G-like module 0.093
Further Details:      
 
Domain Number 2 Region: 148-267
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000214
Family Cadherin 0.0067
Further Details:      
 
Domain Number 3 Region: 38-152
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000002
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014953   Gene: ENSDORG00000015895   Transcript: ENSDORT00000015894
Sequence length 960
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4328:26455:253917:1 gene:ENSDORG00000015895 transcript:ENSDORT00000015894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRARLCWVPLLLXXXXXXXXXXXXXXXXXXXXXXXXNKHKPWIETSYHGVITENNDTVI
LDPPLVALDKDAPVPFAGEICAFKIHGQELPFEAVVLNKTSGEGRLRAKSPIDCELQKEY
TFIIQAYDCGAGPRETAWKKSHKAVVHIQVKDVNEFAPAFKEPAYKAVVTEGKIYDSILQ
VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQRQYEILVTAYDCGQ
KPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSVPLFPSIHLETCDGAVSSLQVTAE
LQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSGEMIFRFDG
RQGAKIPDGIVPKNLTDQFTITMWMQHGPSTGVRAEKETILCNSDKTEMNRHHYALYVHN
CRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLV
TNDWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHGSLASLTIRPGKMESQKVISCLQA
CKEGLDINSLESLGQGIKYHFNPSQSVLVMEGDDIGNINGALQKVSYINSRPFPTAGVRR
LRLSSQVQCFGEDVCISIPDVDAYVMVLQAIEPQITLQGTDRFWRPAAQFQSARGVALFP
DIKIVSTFAKAEPSSDMKTAAPRAAVLEEMLHNLDFCDILVLGGDLDPRQECLELSHSEL
HQRHLDATNSSAGYSVYGVGSMSRYEQVLRHLRYRNWHPTSLEARQFRIKCSELNGRYTS
NEFNVEVGVLHEVRVSDEHVNHLIVQPPFLQSVHHPESRSSIRRSSVVPSIATVVVIISV
CMLVFVVAMGVYRVRIAHQHFVQETEAAKEAEMDWDDSALTITVNPMEKHEGPGHGEDET
EGEEEEEEEGAEEDLSSSSSSSSSSEDGEEEEEEVMGRGQRRQSGAQRAQLEWDDSTLPY
Download sequence
Identical sequences ENSDORP00000014953 ENSDORP00000014953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]