SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014954 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014954
Domain Number 1 Region: 158-262
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-39
Family Link domain 0.0081
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-24
Family Link domain 0.0025
Further Details:      
 
Domain Number 3 Region: 49-155
Classification Level Classification E-value
Superfamily Immunoglobulin 5.42e-16
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014954   Gene: ENSDORG00000015896   Transcript: ENSDORT00000015895
Sequence length 354
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_6037:31621:57196:1 gene:ENSDORG00000015896 transcript:ENSDORT00000015895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLVLISICWADHHSDNYTLNHDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDN
DASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYFPRLGRYNLNFHEARQA
CLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLHDGAQIAKVGQIFAAWKLLG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences ENSDORP00000014954 ENSDORP00000014954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]