SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014976 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000014976
Domain Number - Region: 197-234
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00968
Family Frizzled cysteine-rich domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014976   Gene: ENSDORG00000015919   Transcript: ENSDORT00000015919
Sequence length 501
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5906:4648:668320:1 gene:ENSDORG00000015919 transcript:ENSDORT00000015919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLE
NAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQ
LINPQYHFNEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANR
VSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDA
MLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSAR
SAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDERVTA
GTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKL
KNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAADPDRREEDSSAARL
SHSLLSLSVACVVLALQRLCR
Download sequence
Identical sequences ENSDORP00000014976 ENSDORP00000014976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]