SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014990 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000014990
Domain Number - Region: 408-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family Follistatin (FS) module N-terminal domain, FS-N 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014990   Gene: ENSDORG00000015935   Transcript: ENSDORT00000015934
Sequence length 641
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4036:2102:20953:-1 gene:ENSDORG00000015935 transcript:ENSDORT00000015934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTVLIFLYILGTTAAIPTTARFLSDYSKPTAEILVTPDNTAIPIAEVEAAEKEAGAATE
STPNHKAEKSSIQRSEEENPDQSVEQDKTDSQELGLKDQEDSDGDVSVNLEYSPTEGTLD
SKEDLSETPKKHFPENTDSSAAAFSSNVESHQENTAKGEENEEQPINELFELNKNSSHSE
DLIDEGNQEQNPNIPNGDGEEGEKEPEEDGVLNDDQENEKEVSNEHSNRKQEEDNDQPDA
LLEDSNPPTQASEMQDESEQSHQDQGENSNAEMDEDHILHSSKQSEEGKTDLEITDNQED
IDIKTAPTESTDDGDVLSKSHGAESDRENDDPKHGESDDYLMPSEDSLEAEKGQPISSYL
KHEQERSQEDENVDTSETGGYQEVKKAESSSHDDEPSSEDNSRLHNADSCMNFQCKRGHI
CKAEPQGKAHCVCQDPATCPPAKLLDQACGTDNXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIDENLLF
Download sequence
Identical sequences ENSDORP00000014990 ENSDORP00000014990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]