SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015034 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015034
Domain Number 1 Region: 333-696
Classification Level Classification E-value
Superfamily SIS domain 1.67e-96
Family double-SIS domain 0.000000575
Further Details:      
 
Domain Number 2 Region: 114-211
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00000000000003
Family Class II glutamine amidotransferases 0.0011
Further Details:      
 
Domain Number 3 Region: 1-69
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0000518
Family Class II glutamine amidotransferases 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015034   Gene: ENSDORG00000015980   Transcript: ENSDORT00000015980
Sequence length 696
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5194:286204:324082:-1 gene:ENSDORG00000015980 transcript:ENSDORT00000015980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFAYLNYHVPRTRREILETLIKGLQRLEYRGYDSAGVGFDGGNDKDWEANACKIQLIKKK
GKVKALDEEVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIVIHN
GIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNWESQDISFTTLVERVIQQLXX
XXXXXXXXXXXXXXXXXXXRGSPLLIGVRSEHKLSTDHIPILYRTARTQIGSKFTRWGSQ
GERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVIEHTNRVIFLEDDDVAAVV
DGRLSIHRIKRTAGDHPGRAVQTLQMELQQIMKGNFSSFMQKEIFEQPESVVNTMRGRVN
FDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFL
DRNTPVFRDDVCFFISQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHIN
AGEVGVASTKAYTSQFVALVMFALMMCDDRISMQERRKDXXXXXXXXXXXLIKEVLSMDD
EIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDK
LMPVIMIIMRDHTYAKCQNAFQQVIARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQ
GILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSDORP00000015034 ENSDORP00000015034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]