SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015063 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015063
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-19
Family Kringle modules 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015063   Gene: ENSDORG00000016014   Transcript: ENSDORT00000016014
Sequence length 263
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5866:53184:70449:-1 gene:ENSDORG00000016014 transcript:ENSDORT00000016014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLIWVQTFLLSTTLITDAFGSGGCFWDNGHLYREDQPSPAPGLLCLNWRDAPVGLATAP
ELGIDHHNYCRNPDRDPRGPWCYVSSEAGAPEKRLCEDLRCPXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXGKDLKEQHEQKVCERELQRITLPLSAFTNPTCEIVDEKTIVVHT
NQTPVDLQEGSTPLMGQAGTPGA
Download sequence
Identical sequences ENSDORP00000015063 ENSDORP00000015063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]