SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015068 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015068
Domain Number 1 Region: 1179-1345
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.84e-67
Family Fibrinogen C-terminal domain-like 0.0000044
Further Details:      
 
Domain Number 2 Region: 595-768
Classification Level Classification E-value
Superfamily Fibronectin type III 3.95e-24
Family Fibronectin type III 0.0000096
Further Details:      
 
Domain Number 3 Region: 328-503
Classification Level Classification E-value
Superfamily Fibronectin type III 2.08e-20
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 778-938
Classification Level Classification E-value
Superfamily Fibronectin type III 2.21e-20
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 5 Region: 955-1082
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000106
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 6 Region: 502-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000722
Family Fibronectin type III 0.00000415
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015068
Domain Number - Region: 300-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 208-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0022
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family Integrin beta EGF-like domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015068   Gene: ENSDORG00000016019   Transcript: ENSDORT00000016019
Sequence length 1358
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2016:9394:86154:-1 gene:ENSDORG00000016019 transcript:ENSDORT00000016019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGADGETVVLKNMLIGVNLILLGSMLKPSECQLEVTTERVQRQRGEEEGGVSNYNTTSKE
QPMVFNHVYNINVPLESLCSSGLEASAEQEVSAEDETLAEYTGQTSDHESQVTFTHKINL
PKKACPCASSVQVLQELLSRIEMLEREVSLLRDQCNANCCPESAATGQLDYIPHCSGHGN
FSLESCGCICDEGWVGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
ARGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCQEGYAGHDCGQRRCLNA
CSGRGHCQEGLCLCEEGYEGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKAITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQLPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWTPPRARVDFILLKYGL
VGGEGGKTTFRLQPPLSQYSVQALRPGSHYEVSVSAVRGTNESDAATTHFSTEIDAPKNL
RVSSRTATSLELEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPIGLGPTTRTTLTALVPGT
EYGVGISAIMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHTVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSLTVSWSPPAASFDYYRVSYRP
TQVGRLDSSVVPNTVSEFTITRLYPATEYEISLNSVRGREESERICTLVHTAMDNPVGLT
ATNITPTEALLQWKAPVGDVENYVIVLTHFAVAGETILVDGVSEEFQLINLLPRTNYTVT
MYAASGPLTSGTISTNFSTLLDPPTNLTASDITRQSALISWHPPRAEIENYILTYKSTDG
SRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRVFSHPQDXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFQRRQNGQTDFFRKWANYRAG
FGNLEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAVFAHYDKFSVEDSRNLYKLRLGGY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRVSAGRKRRALQF
Download sequence
Identical sequences ENSDORP00000015068 ENSDORP00000015068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]