SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015076 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015076
Domain Number 1 Region: 211-356
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.14e-32
Family AlaX-like 0.019
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000000774
Family Co-chaperone p23-like 0.00074
Further Details:      
 
Domain Number 3 Region: 152-210
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000325
Family AlaX-M N-terminal domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015076   Gene: ENSDORG00000016028   Transcript: ENSDORT00000016028
Sequence length 525
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1608:7480:17932:-1 gene:ENSDORG00000016028 transcript:ENSDORT00000016028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFCVEDSTDVRVLLEDHRIVFSCKNGDGVELYNEIEFYAKVNSKDSQDKRSGRSITCFV
RKWKEKVAWPRLTKEDIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXFTTAVVSCRPAELQREGRDGEKEVLSGFQVVLEDTLLFPEGGGQPDDRGTINGI
SVLRVTRRGAQADHFTQTSLAPGSQVQVQVDWERRFDHMQQHSGQHLITAVADHLFGMKT
TSWELGRLRSVIELDSPSVTAEQVAAIEQSVNEKIRDRLPVSVRELSLDDPEVEQVRGRG
LPDDHAGPVRVVTIEGVDSNMCCGTHVRNLSDLQVIKILGTEKGKKNKTNLVFLAGNRVL
KWMERSHGTEKALTALLKCGAEDHVDAVKKLQNSTKLLQKNNLNLLRDLAVHIAHSLQSS
LDCGRVVTLHRKEGDSEFMNIIANEIGSKETLLFLTVGDEKAAGLFLLAGPAEAVETLGP
RVAEVLEGKGAGKKGRFQGKATKMSRRAEAQALLQDYVSTQSAEE
Download sequence
Identical sequences ENSDORP00000015076 ENSDORP00000015076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]