SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015110 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015110
Domain Number 1 Region: 211-286
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 4.58e-28
Family Leukotriene A4 hydrolase N-terminal domain 0.0062
Further Details:      
 
Domain Number 2 Region: 431-545
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.54e-17
Family Leukotriene A4 hydrolase catalytic domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015110
Domain Number - Region: 81-121
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.000366
Family Leukotriene A4 hydrolase N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015110   Gene: ENSDORG00000016065   Transcript: ENSDORT00000016065
Sequence length 828
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3265:48845:103086:1 gene:ENSDORG00000016065 transcript:ENSDORT00000016065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFAEEEGSKRYCIKPKHVAILCAVVVAVGLIVGLSVGLTRSCDAGQGPAPAPSAHPPTA
SPSELPPQDQGVCPASLDESGAWTNFRLPEFVRPEHYDLEVKPVLEEDTYTGRVSIAIHL
SAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSIAATDHEPTDARKSFPCFDEPNKKATYTI
SIVHSKDYEALSNMPVEKKEALDDKWTRTTFEKSVPMSTYLVCFAVHQFTPIVKTSNSGK
PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXREQVLLEDVLPVQEDDSLMSSHPVVVTVTTPAEITSVFDGISYSKGASI
LRMLEDWMTPEKFQKGCQXXXXXXXXXXXXXXXXXXXXXXASNLPVKEVMDTWTSQMGYP
VLNVNNLRDISQKRFLLDSHADPSQPPSALGYTWNIPVKWTENNVSSIVVYNRSEKGGIT
LNSPNPGGNALLKINPDHIGFYRVNYEGETWFRIATELSLNHKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYFRSQVK
PIADSLTWEDTGSHITKLLRASVLGFACKMGDREALDNASRLFQSWIAGNGSIPVNLRLL
AYRYGMQTSGNETSWNYTLAQYQKTSLAQEKEKLLYGLASVKNVTLLA
Download sequence
Identical sequences ENSDORP00000015110 ENSDORP00000015110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]