SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015122 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015122
Domain Number 1 Region: 888-1171
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.2e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000373
Further Details:      
 
Domain Number 2 Region: 1134-1431
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000179
Further Details:      
 
Domain Number 3 Region: 2-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-36
Family MAM domain 0.000000647
Further Details:      
 
Domain Number 4 Region: 360-554
Classification Level Classification E-value
Superfamily Fibronectin type III 1.74e-27
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 162-255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000541
Family I set domains 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015122   Gene: ENSDORG00000016079   Transcript: ENSDORT00000016078
Sequence length 1432
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6283:34309:477380:-1 gene:ENSDORG00000016079 transcript:ENSDORT00000016078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCSFDEHYSNCGYSVALGTNGFTWEQINTWEKPMLDPAVPTGSFMMVNSSGRASGQKAHL
LLPTLKENDTHCIDFHYYFSSRDRSSPGALNVYVKVNGGPQGNPVWNVSGVVTEGWVKAE
LAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFLRLQNVEVNVGQNAT
FQCIAGGKWSQHDKLWLQQWNGRDTALMVTRVVNHRRFSATVSVADTAQRSVSKYRCVIR
SDGGSGVSNYAELIVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVHGP
QNVEIVDIRARQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQQYEAEEVIQTSSHYTLR
GLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPLESIQGGPFEEKIYIQWKPPN
ETNGVITLYEINYKAVGSLDPTADLTSQRGKVFKLRNETHHLFVGLYPGTTYSFTIKAST
AKGFGPPVTTRIATKISAPSMPEYDTDSPLNETDTTITVMLKPAQSRGAPVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXETKINCVRLATKVPMGSAQVTPGTPLCLFTTGASTQN
SNTVEPEKQVDNTVKMAGVIAGLLMFIIILLGVMLTIKRXXXXXXXXXXXSQRKLAKKQK
ETQSGAQREMGPVASADKPNTKLSANRNDEGFSSSSQDVNGFXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALPEGQTASWDTAK
EDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDYHRPRHYIATQGPMQETVK
DFWRMVWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTF
TVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAG
RTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNT
AIPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLPRNHDKNRNM
DVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFVVTQHPLPNTMTDFWRLVFDYNC
SSVVMLNEMDTAQLCMQYWPEKTSGCYGPIQVEFVSADIEEDIIHRIFRICNMARPQDGY
RIVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFC
AICSVCEMIQQQNIIDVFHIVKTLRNNKSNMVETLEQYKFVYEVALEYLSSF
Download sequence
Identical sequences ENSDORP00000015122 ENSDORP00000015122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]