SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015160 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015160
Domain Number 1 Region: 9-160
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-38
Family Ankyrin repeat 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015160   Gene: ENSDORG00000016118   Transcript: ENSDORT00000016118
Sequence length 183
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_5898:34495:45092:1 gene:ENSDORG00000016118 transcript:ENSDORT00000016118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRPCADGSCCSHSGAVPGVQQTLEEMDFERGIWSAALNGDLGRVKYFIQKATDPSQP
DSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTEIARLLLSHG
SDPQLVDDDGMTSLHKAAEKGHVDICSLLLQHSPTLKAVRDRKARLACDLLPCDSDLWDL
LAS
Download sequence
Identical sequences A0A1S3FGW0
ENSDORP00000015160 ENSDORP00000015160 XP_012875283.1.60039 XP_012875284.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]