SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015166 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015166
Domain Number 1 Region: 1413-1522
Classification Level Classification E-value
Superfamily C-type lectin-like 2.21e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000074
Further Details:      
 
Domain Number 2 Region: 1525-1637
Classification Level Classification E-value
Superfamily C-type lectin-like 3.06e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015166   Gene: ENSDORG00000016123   Transcript: ENSDORT00000016124
Sequence length 1638
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6185:1641:79413:-1 gene:ENSDORG00000016123 transcript:ENSDORT00000016124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGCAGSGCGKCDCQGVKGQKGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDAGEPGLPG
TKGTRGPPGAAGYPGNPGLPXXXXXXXXXXXXXXXXXXXXXGERGPLGPPGLPGFSGNPG
PPGLPGMKGDPGEILGQVPGMLLKGERGFPGPPGIPGSPGLPGLQGPVGPPGFTGPPGPP
GPPGPPGEKGQMGSSFQGPKGDKGDQGVSGPPGVGQAQVKEKGDFAPTGEKGQKGEPGFQ
GMPGFGEKGEPGKPGPRGKPGKDGEKGEKGSPGFPGDSGYPGLPGQMGPQGEKGDVGLPG
PPGIVIGTGPLGEKGERGYPGTPGSRGEPGPKGYPGLPGQPGPPGLPIPSQVGPPGFPGE
RGEKGSQGLPGVSLPGPSGRDGAPGPPGLPGPPGQPGHTNGIVECQPGPPGDQGPPGIPG
QQGLTGEMGEKGQKGDSCLACDTEGLQGPPGPQGPPGEIGFPGQPGAKGDRGLPGRDGLE
GLPGPQGAPGLMGQPGAKGEPGEIYFDMRLKGDKGDPGFPGQPGMPGRAGSPGRDGHPGL
PGPKGSPGSVGLKGERGPPGGVGFPGSRGDIGPPGPPGFGPIGPIGDKGQAGFPGSPGSP
GLPGPKGEAGKVVPLPGPPGAEGLPGAPGFPGPQGDRGFPGTPGRPGLPGEKGAVGQPGI
GFPGPPGPKGVDGLPGDAGPPGSPGRPGFNGLPGSPGVPGQKGEPGIGLPGIKGQPGLPG
IPGTPGEKGSIGGPGVPGEHGLIGPPGLQGVRGDPGPPGVQGPAGPPGAPGVGPPGAMGP
PGGQGPPGSSGPPGVKGEKGFPGFPGLDMPGPKGDKGAQGLPGLTGQTGLPGPPGQQGTP
GVPGFPGSKGEMGVMGTPGQPGSPGPAGVPGLPGEKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIGPTGDKGSRGDPGTPGVPGKDGQAGHPGQ
PGPKGDPGISGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGIPGIPGEKGAKGE
KGQAGLPGIGLPGRPGDKGDPGLAGFPGSPGEKGQKGSTGIPGMPGSPGPKGLPGSIGYP
GSPGLPGEKGDKGLPGLDGIPGVKGEAGLPGTPGPTGPAGQKGEPGSDGIPGSAGEKGEP
GLPGRGFPGFPGAKGDKGSKGEVGFPGLAGSPGIPGSKGEQGFMGPPGPQGQPGLPGTPG
RPVEGPKGDRGPQGQPGLPGLPGPMGPPGLPGLDGLKGDKGNPGWPGTPGAPGPKGDPGF
QGMPGIGGSPGITGSKGDMGPPGVPGFQGQKGLPGLQGLKGDQGDQGIPGSKGLPGPPGP
PGPYDVLKGEPGLPGPEGPPGLKGLQGPPGPKGQQVTGSAGVPGTPGPGFDGAPGQKGET
GPFGPPGPRGFPGLGPDGLPGSTWPPGTPSVDHGFLVTRHSQTTEDPSCPPGTKILYHGY
SLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPM
SMAPITGDGIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPNGWSSLWIGYSFVMHTSAGA
EGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFXXXXXXXXXXXXKPTPSTLK
AGELRTHVSRCQVCMRRT
Download sequence
Identical sequences ENSDORP00000015166 ENSDORP00000015166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]