SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015191 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015191
Domain Number 1 Region: 151-549
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.66e-79
Family Ankyrin repeat 0.0000135
Further Details:      
 
Domain Number 2 Region: 17-92
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000249
Family Ankyrin repeat 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015191
Domain Number - Region: 884-950
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0114
Family Motor proteins 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015191   Gene: ENSDORG00000016150   Transcript: ENSDORT00000016150
Sequence length 1044
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_171:105214:194568:1 gene:ENSDORG00000016150 transcript:ENSDORT00000016150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPENLLSTGSSLASQVHAAAVNGDKGTLQRLIVGNASFKDKEDQFGRTPLMYCVLADR
LDCADALLKAGADVNKTDHSQRTALHLAAQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTALHWSAYYNNPEHVKLLIKHDSNIGIPDV
EGKIPLHWAANHKDPSAVHTVRCILDAAPTESLLNWQDYEGRTPLHFAVADGNVTVVDVL
TSYESCNITSYDNLFRTPLHWAALLGHAQIVHLLLERNKSGTIPSDSQGATPLHYAAQSN
FAXXXXXXILKHPSVKDDSDLEGRTSFMWAAGKGSDDVLRTMLSLKSDIDINMADKYGGT
ALHAAALSGHVSTVKLLLENDAQVDATDVMKHTPLFRACEMGHKDVIQTLIKGGARVDLV
DQDGHSLLHWAALGGNADVCQILIENKINPNVQDYAGRTPLQCAAYGGYINCMAVLMENN
ADPNIQDKEGRTALHWSCNNGYLDAIKLLLHYAAFPNQMENNEERYTPLDYALLGERHEV
IQFMLEHGALSIAAXQDIAAFKIQAVYKGYKVRKAFRDRKNLLMKHEQLRKDAAAKKREE
ENKRKEAEQQKDWLSPDSHIPQALPCLPSPSKQPPSRPMSQGLTPRDGSGSPLTPPKDQH
VPLDLQKTDSRKTNETSKEHSKGCSACVHVRAREGHGGERRRRVSSVERCRGQTAGEQWR
EKRKDMAKALSPISTVRAAGPEEKGKDPSHAPTSLSQDSHWKASRQQDSAPKTRSVPQKK
CTQEVKGRCSPAGASRPGTAKQEMVCSRQSPRHHRTPKSKVTPKLVGEIYSDLPQNTEMR
SKPRKPGTSALSEDIQESKETEPTPVHLSAQSVNIDLLPVELRLQIIQRERCRKELFRRK
NQAATIIQRAWRRYQLRKHLSHLVHMKQLGGKDMLRWKRVCTALLIQAWRKELELKLPKT
TSVRRMPKSLAKSTSGTKLTKHSVLKQIYGCSQEGKVYHPTRPSKAPPVLQLNSVSNLQC
IHLESSRSKNFSYNLQSATHPKKQ
Download sequence
Identical sequences ENSDORP00000015191 ENSDORP00000015191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]