SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015207 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015207
Domain Number 1 Region: 362-566
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.95e-39
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 585-792
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.77e-39
Family Laminin G-like module 0.00097
Further Details:      
 
Domain Number 3 Region: 34-230
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-33
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 4 Region: 791-931
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-25
Family Laminin G-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015207   Gene: ENSDORG00000016165   Transcript: ENSDORT00000016166
Sequence length 1015
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4763:91294:259932:1 gene:ENSDORG00000016165 transcript:ENSDORT00000016166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLIPGVWLLLLASSLQPCTAALRASLRKAGKVGPPVDIKLSALNCTAFSIQWTMPRHPV
SPIIGYTVFYSEVDADKSLREQSQSAPLSQDTTVTEEVIGDLKPGTEYQVSIAAYSQTGK
GRLSSPRHVSTLSQDSCQPPAAPQQPHVLVVSDSEVALSWKPGESEGSSSMQYYSVEFIR
PDLDKSWTIIQEQIQMDSMVIKGLAADTNYQFAVRAVNAYGSSPRSWPSNTIRTLGRKEA
GSGHYGPHYITDMEASEDDDGFEDDLDLDISFEEVKPLPATKGGNKKFLVETTMTSLSNP
KTFSQLAPPTSASLPATVTVAVQPTPAERKGKTSVAMMSRLFDMSCDETLCSADSFCAND
YTWGGSRCHCNLGKGGEGCSEDIVIQYPQFFGHSYVSFEPLKNSYQAFQITLEFRAEAED
GLLLYCGENEHGRGDFMSLAIIRRTLQFRFNCGTGVAIILSESKIKLGAWHTVTLFRDGL
NGLLQLNNGTPSTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGFQGCVQSLAVN
GKRIDMRPWPLGKALSGADVGECSSGICDEASCINGGTCAAIKADSYICLCPLGFKGRHC
EAAFTLTMPHFRESLRSYAATPWPLEPQHYLSFTEFEITFRPDSGDGVLLYSYDTSSKDF
LSINMVGGHVEFRFDCGSGTGVLRSENPLSLDQWHELRVSRTAKNGILQVDKQKAVEGMA
EGGFTQIKCNTDIFIGGVPNYDDVKKNSGIFKPFSGSIQKIILNDRTIHVRHDFTSGVNV
ENAAHPCVRAPCAHGGSCRPRKESYECDCPLGFEGLHCQKECGNYCLNTITEAIEIPQFI
GRSYLTYDNADILKRVSGSRSNVFMRFKTTAKDGLLMWRGDSPMRPNSDFISLGLRDGAL
VFSYNLGSGVASIMVNGSFNDGRWHRVKAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXGMKEIALHTNRQYRGLVGCISHFTLSTDYHLSLVEDAADGKNINTCGAK
Download sequence
Identical sequences ENSDORP00000015207 ENSDORP00000015207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]