SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015231 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015231
Domain Number 1 Region: 3980-4347
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.28e-98
Family Regulator of chromosome condensation RCC1 0.0042
Further Details:      
 
Domain Number 2 Region: 366-540
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.89e-42
Family Regulator of chromosome condensation RCC1 0.026
Further Details:      
 
Domain Number 3 Region: 507-540,604-750
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-41
Family Regulator of chromosome condensation RCC1 0.028
Further Details:      
 
Domain Number 4 Region: 4475-4684
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.75e-38
Family Hect, E3 ligase catalytic domain 0.0014
Further Details:      
 
Domain Number 5 Region: 2011-2163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-30
Family SPRY domain 0.01
Further Details:      
 
Domain Number 6 Region: 3569-3669,3708-3799
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.96e-18
Family WD40-repeat 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015231
Domain Number - Region: 1730-1852,1880-1976
Classification Level Classification E-value
Superfamily ARM repeat 0.00699
Family PBS lyase HEAT-like repeat 0.068
Further Details:      
 
Domain Number - Region: 2734-2792
Classification Level Classification E-value
Superfamily UBA-like 0.00893
Family UBA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015231   Gene: ENSDORG00000016189   Transcript: ENSDORT00000016190
Sequence length 4787
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3363:63619:200553:-1 gene:ENSDORG00000016189 transcript:ENSDORT00000016190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATMVPPVKLKWLEHNSSWITEDSESIATREGVAVLYSKLVSNKEVVPLPQQVLCLKGPQ
LPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNKY
HDKGKVKQQQHSPESSSGSADVHSVCERPRSSTDALIEMGVRTGLSLLFALLRQSWMMPV
SGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGADT
LGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVNTMEKSKLLSSQEGMISFDCFMT
ILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSQT
GDAPVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVISTDGS
VRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVFSWG
DGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSSAVTEDGELYTWGEGDFGRL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLGHGDTNRVY
KPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIEELA
STRIVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAIQQI
SAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLPFPS
SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVI
ETLSVGATMLLPPLRERMELLHSLPQGRDRESLSKGQRMQLDIILTSLQDHTHVASLLGY
SSPSDATDLSSVCTGYGNLADQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAFGELEK
NSDKFLVGTSSSENSQPAHLHELLCSLQKQLLAFCHINNISENSSSVALLHKHLQLLLPH
ATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARPLLSYL
LDLLPPLDCLNRLLPAAALLEDQELQWPLHGGPEVIDPAGVPLPQPAQSWVWLVDLERTI
ALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQLDKCMSCLKVSSGNEEQ
FDYLRPEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWDSATLSNESLLDTVSRFLAAL
LHTNLLSACGSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISDNQDSA
DVDPQEHSFTRTIDEEAEMEEQAERDREEGHVEPEDEEEEREHEVMTAGKIFQCFLSARE
VARSRDRDRMNSGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSESLTAENRLVHASPSYRLIKSRSES
DLSQPESDEEGYVLSGRRNVDLDLASSHRKRGPIHSQLEFLSDSWARLKQSRDWLYNSSY
SFESDFDLTKSLGVHTLIENVVSFVSGDVGNAPGFKEPEESMSTSPQASIIAMEQQQLRA
ELRLEALHQILVLLSGMEEKSSISLAGSRSSSGFQSSTLLTSVRLQFLAGCFGLGTVGHT
GAKGESGRLHHYQDGIRAAKRNIQIEIQVAVHKIYQQLSATLERALQANKHHIEAQQRLL
LVTVFALSVHYQPVDVSLAVSTGLLNVLSQLCGTDTMLGQPLQLLPKTGVSQLSTALKVA
STRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQTGVLLMASFGEGEGEEGEE
GKKVDSNGETEKKDFRAALRKQHAAELHLGDFLVFLRRVVSSKAIQSKMASPKWTEVLLN
IASQKCSSGIPLVGNLRTRLLALHVLEAVLPACETGVEDDQMAQVVERLFSLLSDCMWET
PIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPEKAQCCLVENGQILTHGS
GGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFNHRTTSDMWLYRAYS
GNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAFEDVDAAELYPCVMF
YSSNPGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXSGGRCVHKQTGRHATLLGVVKEGSTSAKVQWDEAEI
TIXXXXXXXXXXXXXXXXXXCEPLPFDVARFRGLTASVLLDLTYLTGIHEDMGKQSIKRH
EKKHRHESEEKGDVEQKPESESVLDVRTSLTSDDVKNQGTTSSKSENEIASFSLDSTLPG
VESQHQITEGKRKNHEHVSKNHDIAQSEIRAVQLSYLYLGAMKSLSALLGCSKYAELLLI
PKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPIKRALGLADLERAQA
MIYKLVVHGLLEDQFGGKIKQDIDQQAEESDQAQQAQTPVTTSPSASSTTSFMSSSLEDT
TTATTPVTDTETVPASESPGVMPLSLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLSDPSSRLSTSPPPPAIAVPLLEMGFSLRQIAKAMEAT
GARGEADAQNITVLAMWMIEHPGHEEEDEPQPGSTADSRHGASILGSGGKSSDPCYLQSP
GDIPSADATEMEEGFSESPDNLDHTENAASGSGPPARGRSTVTRRHKFDLAARTLLARAA
GLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAMEAMFGQDLTSDNDIL
GMWIPEVLDWPTWHVCESEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGSCREKYLALKTKSKTTSSERYKGQAPDLIGKQDSVYE
EDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDPLGASVAMVTATNSM
EETLMQIGCHGSVEKSSSGRITLGEQAAALANPHDRVVALRRVTAAAQVLLARTMVMRAL
SLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLELANALAACC
LSSRLSSQHRQWAAQQLVRTLAAHDRDNQTAPQTLADMGGDLTKCSFIKLEAHQSRXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVTCIAWFSEDRPFAVGYFDGKLLMGTKEPL
EKGGIVLIDAHKDTLVSMKWDPTGHILMTCAKEETVKLWGPVSGCWHCLHSLCHPSIVNG
IAWCSLPGKGSKLQLLLATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGYRKS
AGVKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWFLKDGSVLQTVVIGSGAIQT
TVWIPEVGVAACSNRSKDVLVVNCTAEWIAANHVLATCRTALKQQGVLGLNMAPCMRAFL
ERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLLCSPPVPPHHQNCLP
DPAAWNPNEWAWLECFSTTIKAAEALTNGAQFPESFTVPDLEPVPEDELAFLMDNSKWIN
GMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVIC
GQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHS
MALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGK
LFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDG
DYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEG
RARNHNRPQQIPVLAGVVIEDVAVGAEHTLALASTGDVYAWGSNSEGQLGLGHTNHVREP
TLVTVLQGKNIRQISAGRCHSAAWTAPPVPPRAPGVSVPLQLGLPDTVPPQYGALREVSV
HTVRARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQGQLRSLLAPRVYTL
PMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKLNASDLRLPSRAWKV
KLVGEGADDAGGVFDDTITEMCQELETGIVDLLIPSPNATAEVGYNRDRFLFNPSACLDE
HLMQFKFLGILMGVAIRTKKPLDLHLAPLVWKQLCCVPLTLEDLEEVDLLYVQTLNSILH
IEDSGITEESFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNRKEYVERAIEYRLHE
MDRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRVLFMRFVSGRSRLPANTADISQRFQIMKVDR
Download sequence
Identical sequences ENSDORP00000015231 ENSDORP00000015231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]