SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015245 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015245
Domain Number 1 Region: 169-301
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-23
Family Beta-galactosidase LacA, domains 4 and 5 0.025
Further Details:      
 
Domain Number 2 Region: 1-51
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000316
Family Glycosyl hydrolases family 35 catalytic domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015245   Gene: ENSDORG00000016205   Transcript: ENSDORT00000016205
Sequence length 314
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5596:110019:183246:-1 gene:ENSDORG00000016205 transcript:ENSDORT00000016205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGGTNFGFMNGASYIQKHVGVVTSYDYDAVLTEAGDYTEKYFKLRHLFGSVSAKPLPS
SPHLTPKTVYPAVRPSLYLPLWDALQYLDEAVKSVIPINMENLPINNGSGQSFGFILYET
SICSGGILYAEAHDVAQVFVNNIIIGFLSDKVQKMRIPKFKGCQLLRILVENQGRISYSW
RIQEEKKGLVGSVSINGISLKNFTIYPLEMKKSFFERLRFATWKPGPESYLGPAFYKGIL
KAGSSPVDTFLSLPGWNCGFVFVNGHNLGRYWKIGPQESLYLPGVWLHPEDNEIILFEKI
RRGLSIRSRGKPKL
Download sequence
Identical sequences ENSDORP00000015245 ENSDORP00000015245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]