SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015304 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015304
Domain Number 1 Region: 2675-2786
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-35
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 2 Region: 582-693
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-35
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 3 Region: 1386-1497
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.81e-35
Family Spermadhesin, CUB domain 0.00069
Further Details:      
 
Domain Number 4 Region: 1615-1723
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 1155-1267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-32
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 6 Region: 3142-3267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 7 Region: 1728-1837
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-32
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 8 Region: 3382-3494
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-32
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 9 Region: 1499-1608
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-31
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 10 Region: 2216-2323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 11 Region: 924-1033
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-30
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Domain Number 12 Region: 1269-1378
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-30
Family Spermadhesin, CUB domain 0.00077
Further Details:      
 
Domain Number 13 Region: 2438-2551
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 14 Region: 1847-1954
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-28
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 15 Region: 699-807
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-27
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 16 Region: 3498-3611
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-27
Family Spermadhesin, CUB domain 0.00086
Further Details:      
 
Domain Number 17 Region: 2324-2434
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-26
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 18 Region: 1980-2078
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-26
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 19 Region: 816-919
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-26
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 20 Region: 2903-3024
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-24
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 21 Region: 2557-2673
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-24
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 22 Region: 2791-2904
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-21
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 23 Region: 3067-3136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-18
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 24 Region: 3276-3382
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-17
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 25 Region: 424-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000182
Family EGF-type module 0.007
Further Details:      
 
Domain Number 26 Region: 1102-1149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000288
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 27 Region: 2162-2206
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000641
Family Spermadhesin, CUB domain 0.0061
Further Details:      
 
Domain Number 28 Region: 215-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000029
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 29 Region: 164-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 30 Region: 345-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000062
Family EGF-type module 0.039
Further Details:      
 
Domain Number 31 Region: 384-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015304   Gene: ENSDORG00000016262   Transcript: ENSDORT00000016267
Sequence length 3611
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1537:4655:231533:-1 gene:ENSDORG00000016262 transcript:ENSDORT00000016267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLWILVILSIFTELDAEAGEIEHLRQKRDTNLQQPRITAERGNLVFLTGSAQNIEFRTG
SLGKIKVNDDDLSECVHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPHCSDDVNECVMGTLMGCQNGA
TCINTMGSYRCDCSPETYGTRCEFKYDDCKGVSKQRCVHGICEDLDRVENGQPKFSCICE
AGWTFSPNNPACTEDIDECLHDPSPCSELVTCVNTQGSFYCGACPTGWQGNGYYCQDINE
CEIDNGGCSVAPLVQCVNTLGSFKCGDCPPGYKGNGKVCTPIDICLVNNGGCHPQASCSS
SLGSLPLCTCLPGYTGNGYGLNGCVLLSGHCSGHPCLHGQCTETVTGYLCKCEPGWAGAN
CSENINECASNPCLNGGTCVDGINSFSCECTSSWTGDHCQTAQQXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGGILNGTYGSIKSPGYPG
NYPPGRDCVWRILTSPGLLITFTFGTLSLESHEDCNKDYLEIRDGPLPQDPVLGKYCTTL
SVPPLKTTGPFARIHFHSDTQISDQGFHITYLTSPADLQCGGSYTNPEGEILLSDFSGPL
AHGGQCIYIITLPPGEQIDLNFTHVELEGQNGCSHSYIEVRDDDTLLGKLCSNELLTPLR
SITNKVWIRFKTDASIQRASFRAAYQTACGGEVTGEGTIRSPFYPNVYPGERTCRWTIYQ
PQGQIIHLNFTGFHVGTSTNCDTDYVEIGTSPILGSPGNPKYCASNRPSDITSMHNILYV
TFVKSSSPENHGFMAKFSTEHLACEEVLTGSTGTIVSPGSPVYPNGVNCTWNILVQPGHL
IRFEFKKFHLEFHSNCTKDYLEVYDAGTETSLGRYCGKSILPSLTSRSNSVMLIFVSDSD
LGRERFEITYTSINASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXDGGYENSPILGTFCGSVLPPTILSHSNQLWLKFKSDQAI
SSSGFSAYWDASATGCGGNFTTSTGVFTSPNYPMPYYHSSECYWLLKASHGSPFQLNFTE
FHLEYHPNCSLDYLAVYDGPSSSSQLLAQLCGDKKPAPILSSGDSLFLKLRTNEDQQGSG
FMVNFKQICDNVVIANQTYGILESINYPNPYSPNQRCNWTIQATKGNTVNYTFLGFEMEH
SPNCSLEYLELYDGPNRIGRYCGTQNPPAGSTTTSRLHVLFHTDRYNHQEKGFQMQWFVH
GCGGELSGASGTFSSPGYPQNYPHNKECLWYLTTEPGSSIQLTIHDIDMEFYRDCLYDAL
EIYGGPDFHSPRIAQLCDRGSRTPLQVTSSGNKLSVLFRTDYRENGRGFNASWQAVPGGC
GGIFQAPNGEIHSPNYPNYYRSNTDCSWVIQVEQHHRVLLNFTDIDLEPPDSCIMTYDGA
TSATTRLARVCGRQQPASSITSSGNTLFVRFQSGTSRQSRGFRARFKQVCGGYSITDSSG
TISSPLYPNKYANDENCSWILQAQPPFNHITLSFIHFGLESSSNCTRDFVEILDGNSLDA
PLRGRYCGRSLPHPITSFGNALVLRFVSDAGLTDDGFQVLYAASTSACGGNLHMGEGIFD
SPGYPDVYPPNVECVWNIVSSPGNQLQLSFISFQLEDSPNCSKDFLEIREGNATGRLVGR
YCGNSLPHNYSSIVEHILWVRFVSDGSGSGTGFQAGFAKIFGNNNIVGSHGRIASPFWPG
NYPDNSNYKWTVTVNTSQVIHGRILELDIELTTNCYYDKLMLYDGIDIHSRLIGTYCGTQ
TGSFSTTRNSLTVHFSSDSTLSRKGFLLEWFAVDLPSGILPTIPPGSCGGFITTGDRPMF
LFSPGWPDTYSDFLDCTWIIHADSTVEFNLLSVDIESHQTCQFDKLVIRDGENDVAPQLA
TVCGKEIPGPIRSTGEYMYLRFTSDSSRTGAGFNASFHKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKNGADLSSPPLGPQGG
NGRFCGNHPSSTVFTSDNQMFVQFISDRTQGGQGFKIRYEAKYLACGGNIYIHGADSEGY
VTSPSYPANYPQNVDCIWILEALPGRSILLTFEDQFNIEATPNCTSSYLEVRDGADSNAP
ILSKSCGISLPRKQVSSREMMYLRFQSDNSPTHVGFKAKYSIAQCGGTVAGQSGVIESIG
YPSLPYPHNSLCQWHLQGLQGHYLTIFEDILQDSPGCGKDFVEIWENNTSAHLLGRYCGN
TIPARIETSSNVALVRFVTDDSVASLGFRLQFQSSIESCGGDLRVPMGTFTSPNYPFPNP
HGRLCEWRITAEEGRKITLTFDDLKLGIRPSCENERVIVYNGIRSNSPQLETLCSTVNVT
TFFQSSGNMMKVVYFSDGSLPYGGFKASYTSSEDAVCGGTLSNVLGGNFTSPGYSRLTKY
SKNLNCEWTISNPKHENSSIYIQFNHFFLESHQDCQSDALEFRLGDAYGPLINKFCGPTR
PAFPVVIPYSQVWVHFFTNERDERSGFKAKYFFTDCGGIQIGESGVVTSPNYPGTYSNSS
HCAWLLEAPPGHTITLTFRDIDIENHVTCSWDSVTVRNGGLPTSPIIGRYCGTSNPRTIH
SGSNQLLVLFNSDYSVSGGGFYATWNSQTLGCGGIFHSDSGTIQSPYWPQNFPPNSQCSW
TAITHESEHLEIHFDRNFRIPSADAQCQNSFVKVWSGTEETNDTLLATICGDVAPSPIVL
PENTFTAVFQSQEMPAQGFSAFFFSRCGRNFTNSMGYILSPNFPKQYDNNMNCTYIIEAD
AQSVVSLTFVNFRLEARSAITGRCDHDGLHIIKGYSLSFTPIATVCGSETLSPITLAGPV
SLNFYSNSHITDYGFKISYSIYPCDEYNASSGTLQSTSYSFKXXXXXXXXXXXXXXXXXX
XXXXXXXFSDFDVDPSAFCSQDYLGIYDGSDTNAPLLGKFCGSTPPANIKSSNRSMTLLF
KTDSYLTARGWKVTYRQTIGPKHGCGGYVSGSQGSLVSPDSDSNGRYDKGLNCIWFITAP
DNKLINLTFNTFVLEHSSSLGRCAYDYVKIFDGENEHADLAGTFCGSTVPAPFISSGKFL
TIQFVSDLSLERDGFNVTYTFVDMPCGGTYNATWIPQSLSSPHLSTPSFPFSMCTWVIQA
PPQQQVKITVDALKLLSPDCEQNYLQLQDSPQNNGNSRMQFCSTNVSTVPAFYSSTHTAI
VLFKSEVLNRDSEVSFTYQLADCNREYNQAFGTLKSPGWPNNYNGDMDCTVILNAPQDHN
ISLFFQSFALEDSNECSHDFLEIRNGGDNSSPLIGKYCGTLVPNPVFSHRNKLYLRFKSN
SDISNHGYEILWTSSPSGCGGTLYGDAGLLTSPGFPSTYPNNTHCEWTVFAPSGRPLTIS
FDPVIIDDPGNCIQNYLILYNGPDVNSPPFGPYCGADTSIAPFVASSNRVFIKFHAEYAT
RPSSFRLRWQS
Download sequence
Identical sequences ENSDORP00000015304 ENSDORP00000015304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]