SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015346 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015346
Domain Number 1 Region: 345-531
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2e-29
Family Prokaryotic proteases 0.006
Further Details:      
 
Domain Number 2 Region: 181-286
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000251
Family Prokaryotic proteases 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015346   Gene: ENSDORG00000016309   Transcript: ENSDORT00000016309
Sequence length 565
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_22797:5704:13245:-1 gene:ENSDORG00000016309 transcript:ENSDORT00000016309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQWGPSMRAAEQAGCVVSASRAGHPKAGWWSCSGVILSRSPGLVLCHGGIFTPFLRAG
SGVLTATSAAFLPGDSCGDDLCLHVQWGPTAESPAVRAEPSHPGLSMPRCAGLEPSPPLP
PRGRPLQPPRPAKLLLLLSCPAFRAHFTRLFGGEAAEHWHFVNAAPDDEVSEEEEEDQLR
ALGWFALLRVEPGPEAEEGCGPAVAVAPLGSVPKGAPLLACGSPFGAFCPDIFLNTLSRG
VLSNAAGPLLLTDARCLPGTEGGGVFAARPAGALVALVAAPLCWKAREWVGLTLLCAAAP
LLHAARAALASLTPNSAALTALLPPEVGAPRGLPLQDPGPPWAAAAVLVECGTVWGSGVA
VAPRLVVTCRHVAPREMAKVQIHSTMPKNVAIWGHVVFATQETSPYDIAVVRLEEDLDGV
PTPVPAEHFHEGEAVSVVGFGIFGQACGPSVTSGILSAVVQVDDTPVMLQTTCAVHGGSS
GGPLFSTHSGDLLGMVTSNTRDNNTGATYPHLNFSIPITVLQPALRRYNQTGDLGGLREL
DHAAEPVRVVWRLQQPLPQAPRSKL
Download sequence
Identical sequences ENSDORP00000015346 ENSDORP00000015346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]