SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015377 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015377
Domain Number 1 Region: 319-485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-26
Family SPRY domain 0.068
Further Details:      
 
Domain Number 2 Region: 155-278
Classification Level Classification E-value
Superfamily ARM repeat 0.00000181
Family HspBP1 domain 0.076
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015377
Domain Number - Region: 520-566
Classification Level Classification E-value
Superfamily RING/U-box 0.000574
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015377   Gene: ENSDORG00000016341   Transcript: ENSDORT00000016341
Sequence length 574
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4396:1814:28163:1 gene:ENSDORG00000016341 transcript:ENSDORT00000016341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVFGWAVFLASRSLGQGLLLTFEEHIAHLLGTIGATTTMGNSCICRDDSGAEDSVDTHQ
QQAENSAVPTADTRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQE
PPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTE
ILNLNGEVACQDSGHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQCLKLQSHP
TVMLFALIALEKFAQTSENKLTISESSISDRLVTLESWAYEPDYLKRQVGFCAQWSLDNL
FLKEGRQLTYEKVDLSSIRAMLNSNDVSEYLKISPHGLARCDASSFESVRCTFCVDAGVW
YYEVTVVTSGVMQIGWATRDSKFLNHEGYGIGDDEYSCAYDGCRQLIWYNARSKPHAHPC
WKEGDTVGFLLDLNEKQMIFFLNGNQLPPEKQVFSSTVSGFFAAASFMSYQQCEFNFGAK
PFKYPPSMKFSTFNDYAFLTAEEKIILPXXXXXXXXXQVSIRENCCSLCDEVADTQLKPC
GHSDLCMDCALQLETCPLCRKEIVSRVRQISHIS
Download sequence
Identical sequences ENSDORP00000015377 ENSDORP00000015377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]