SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015386 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015386
Domain Number 1 Region: 556-664
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.82e-20
Family Ankyrin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015386
Domain Number - Region: 328-355
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00867
Family DNA primase zinc finger 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015386   Gene: ENSDORG00000016349   Transcript: ENSDORT00000016350
Sequence length 688
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_874:909:45499:-1 gene:ENSDORG00000016349 transcript:ENSDORT00000016350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPDVNIYYTLDGSKPEFLKRIGYGENNTFKYTKPITLPDGKIQVKAIAVSKDCRQSGIVK
KVFQMGYEPPKIVFSEDNIENVLKDSSKQAXELKNGFDGSKLRKKYKNAENKSSWNVNLR
KFPESPLEIPAYREESISRSSTHQSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCAHCL
APYPTDPYARFCQECGAPVPPIFGCRLPPPEGAQMGLCVECGSMVPMNIPICVVCEAPLA
PQLRPQASLHLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMYSGDKALLTPSKGEI
ISCSQGCWNLWDASFWHRCGAPLNLPASHSVCPKCGASNHLSAQFCGSCGIYVKSRIRLS
LDSGLALVAGEPGPFPESLNVPISHDGTRKNMGTQTAGLFYPSGKLLAQKELEMASHKQR
LEKMNDHKPFITAISPGRGYWRKQLDHISAHLRSYAQNNPEFRALIAEPRMGKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRNPKTKKFHKRKEQLV
PENRLLLEEVGPTGEGRVSVLEQLLDEGADPNCSDNEGRPAITVAVVNKHHEAIPVLAQR
GADIDQQWGPFRNTALHEATLLGLEESVTMLLGCNASIQKKNARGQTAYDVALEIADDLI
IKLFATKFSQGLEDQPTQSKNLSLSDCK
Download sequence
Identical sequences ENSDORP00000015386 ENSDORP00000015386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]