SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015433 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015433
Domain Number 1 Region: 143-328
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.39e-37
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 34-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-35
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00088
Further Details:      
 
Domain Number 3 Region: 331-511
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.43e-32
Family Laminin G-like module 0.0047
Further Details:      
 
Domain Number 4 Region: 965-1018,1080-1214
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-32
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 5 Region: 775-957
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.79e-28
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 568-626
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000127
Family Fibrinogen C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 7 Region: 540-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000188
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015433   Gene: ENSDORG00000016403   Transcript: ENSDORT00000016403
Sequence length 1384
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_225:26715:40739:1 gene:ENSDORG00000016403 transcript:ENSDORT00000016403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMHLGLCVLLAAAVSGARGWGYYGCDEELVGPLFARSLGASSYYSLFTTARFARLHGISG
WSPRIGDPNPWLQIDLMKRHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQQGHN
ATFFGNVNESAVVRHDLHYHFTARYIRIVPLAWNPRGKAGLRLGIYGCPYKSDILYFDGD
DAISYRFPRGVSRSLWDVFAFSFKTEEKDGLLLHTEGAQGDYVTLELQGAHLVLHMSLGS
SPIPRPGHTTVSAGGVNDQHWHYVRVDRYGREANLTLDGYVHRFILNGDFERLNLDTEIF
IGGLVGAAHKNLGYRHNFRGCMENVIFNRVNIADLAVRRHSRITFEGKVAFRCLDPVPHP
INFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSRMGDGLGHVELMLSEGQVNVS
IAQTGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTGTSY
FFGGCPKPASRWGCHSNQTAFHGCMELLKVDGQLVNLTLVEFRRLGYFAEVLFDTCGITD
RCSPNMCEHDGRCYQSWDDFICYCELTGYKGVTCHEPLYKESCEAYRLSGKTSGNFTIDP
DGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMERPFLGAVQYWNASWEEVSAL
ANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGLDRS
CVDPALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVVGDTNRSSSEAQFFLRPLRCYGDR
NSWNTISFHTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPFCQWRRPYVRVEL
NTSRDVVFAFDVGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLRPMP
LQTYIWLEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTFPNCTGHCV
HPRFPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSAAR
EFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNVTGE
EVSFSFSTNSAPAVLLYVSSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVTDGQ
PHSVNITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQRYN
TPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEALRVQGELSESNCGAMPRLVSEVPP
ELDPWYLPPDFPYYHDDGWVAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNEPKA
THDYHPGSKTPLPPSGPAQAPAPTPAPTQVPAPAPAQAPAPAPATGPGPRDQNLPQILEE
SRSE
Download sequence
Identical sequences ENSDORP00000015433 ENSDORP00000015433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]