SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015441 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015441
Domain Number 1 Region: 348-437
Classification Level Classification E-value
Superfamily Integrin domains 1.1e-32
Family Integrin domains 0.00000422
Further Details:      
 
Domain Number 2 Region: 105-177
Classification Level Classification E-value
Superfamily vWA-like 2.97e-23
Family Integrin A (or I) domain 0.0000314
Further Details:      
 
Domain Number 3 Region: 284-352
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000222
Family Integrin A (or I) domain 0.0000331
Further Details:      
 
Domain Number 4 Region: 56-131
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000000146
Family Integrin domains 0.00014
Further Details:      
 
Domain Number 5 Region: 1-55
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000146
Family Plexin repeat 0.0000424
Further Details:      
 
Domain Number 6 Region: 562-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 7 Region: 520-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Integrin beta EGF-like domains 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015441
Domain Number - Region: 489-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015441   Gene: ENSDORG00000016410   Transcript: ENSDORT00000016411
Sequence length 760
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_349:2522:42773:1 gene:ENSDORG00000016410 transcript:ENSDORT00000016411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NICTSRGVSSCQQCLAVSPVCAWCSDEALPQGSPRCNLKDNLLRDNCAPESIEFPVSEAQ
ILEARPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKIFSIQVRQVEDYPVDIYYLMDLSY
SMNDDLSSIRNLGTKLASQMRSLTSNLRIGFGAFVDKPVSPYMYISPAEALKNPCYXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYPSLGLMTEKLSQK
NINLIFAVTKNVVNLYQNYSELIPGTTVGVLSADSSNVLQLIVDAYSKIRSKVELEVRDL
PEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPKEKEKAFTIKPVGFK
DSLTVQVTFDCDCACQAHAQPFSQRCNHGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQ
QDECSPKEGQPACSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQC
NCGDCQCDSDWTGFYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCP
TCPDACTFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCPKGPDILVVLLSVMGAILLIGLATLLIWKLLITIH
DRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRSA
Download sequence
Identical sequences ENSDORP00000015441 ENSDORP00000015441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]