SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015442 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015442
Domain Number 1 Region: 114-177
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.67e-21
Family Dual specificity phosphatase-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015442   Gene: ENSDORG00000016412   Transcript: ENSDORT00000016412
Sequence length 223
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5801:132238:153705:1 gene:ENSDORG00000016412 transcript:ENSDORT00000016412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDVKLAFPSLPQCKEDAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVLVHG
NAGISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTI
QMMSPLQIERSLSVHSGNTGSLKRTHEEDDDFGNMQVATAQNG
Download sequence
Identical sequences ENSDORP00000015442 ENSDORP00000015442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]