SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015473 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015473
Domain Number 1 Region: 36-131
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-36
Family Link domain 0.00000241
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015473
Domain Number - Region: 221-248
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000497
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015473   Gene: ENSDORG00000016446   Transcript: ENSDORT00000016446
Sequence length 277
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2380:8143:26262:1 gene:ENSDORG00000016446 transcript:ENSDORT00000016446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVLIYLFLLLWEEAQGWGFKNGIFHNSIWLEQAAGVYHREARSGKYKLTYTEAKAVCEF
EGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGFRLNRS
ERWDAYCYNPHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVMTLKFLSDASITAGGF
QIKYVAVDPVSKASQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences ENSDORP00000015473 ENSDORP00000015473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]