SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015490 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015490
Domain Number 1 Region: 889-1069
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.47e-38
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 479-683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.32e-35
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 695-885
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-34
Family Laminin G-like module 0.0057
Further Details:      
 
Domain Number 4 Region: 285-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 24-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.43e-29
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 1102-1252
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-28
Family Laminin G-like module 0.00000307
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015490
Domain Number - Region: 207-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000332
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015490   Gene: ENSDORG00000016463   Transcript: ENSDORT00000016464
Sequence length 1706
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6443:16018:110656:-1 gene:ENSDORG00000016463 transcript:ENSDORT00000016464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGSRWRPPPLLLLLLALAAGARGLEFGGGPGQWARYARWAGAASSGELSFSLRTNATR
ALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRDARR
TALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLANLK
LGERPPALLGSQGLRGAAADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCSE
EEHPIEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCYDLS
HNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEALVEP
VNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGYTQEDYTMLGS
DDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLS
FRCEDVAALDPVTFESPEAFVALPRWSAKRTSSISLDFRTTEPNGLLLFSQGRRAGAGAG
SHSAAQRADYFAMELLDGYLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSIS
VNSRSTPFLATGESEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFI
DGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFVCDCIGTGFLG
RVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRL
ELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGRSLQLSVDNVT
VEGQMAGAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITY
CELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGN
DFIVIELVKGYIHYVFDLGNEPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTV
TQHSNGARNLDLKGELYIGGLSKNMFSNLPKLVASRDGFQGCLASVDLNGRLPDLIADAL
HRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGK
GGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVI
FNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIA
RQRIPYRLGRVVDEWLLDKGRQLIIFNSQAAIKIGGDGRPFQGQVGLYYXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRSPFVPPP
PTFYPFLTGLGATQDTLPPPAARRPAPGGPCQAEREDSDCEEPIEASGFASGEVFDSSLP
PTDDEDFYTTFPLVTDRTTLRAPRKPAPRPNLRTDGATGAPGVLLAPSAPAPNLPAGKMN
HRDPLQPLLENPPPAGPGAPTAFEPRRPPPRPGASSAPGFPHLPTASPTGPGERGPPGAV
EVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGA
VVKEKAPAAPKTPSKAKKNKDKEYYV
Download sequence
Identical sequences ENSDORP00000015490 ENSDORP00000015490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]