SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015504 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015504
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.44e-17
Family AN1-like Zinc finger 0.0000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015504   Gene: ENSDORG00000016480   Transcript: ENSDORT00000016479
Sequence length 249
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2843:22924:31862:-1 gene:ENSDORG00000016480 transcript:ENSDORT00000016479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPFVCDGCSGIFXXXXXXXXXXXXXXVTIINERVQTNTHKSYPCSYKDCTEKELVAVIC
PFCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIIESKTGEIANKRRKGAKNSET
AAKVALMKLKMHADGDKSLPQTERVYFQVFLPKGRKEKSKPMFFCHRWSVGKVVDSAASL
ASLKNDNNKLTAKKLRLCHSTSGEALPLDDTLEMWITKEDYPLYNGGNIILEYLDAEEQS
LKNIESYLE
Download sequence
Identical sequences ENSDORP00000015504 ENSDORP00000015504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]